PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g077950.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 380aa    MW: 41588.6 Da    PI: 8.1284
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g077950.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76e-393089362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  Sopim02g077950.0.1 30 PPHLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 89
                        5679*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-333287IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5253387IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-283387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDSNGTNAAT SNNMEKPIQD PSQQQQQQPP PHLKCPRCDS SNTKFCYYNN YSLSQPRHFC  60
KACKRYWTRG GTLRNVPVGG GCRKNKRIKR PSVNSSSSTT TTSHDIITTS TPNIVNPSHH  120
HQLHHGVVHN NIDHLSTTNS QNHLNPLFYG LTHERSDLNI PFARLFNSRV SSHAGGVDPE  180
GQVYSLTDNI PGLMDRRMGL GFSNSSGGVV NMGHENNNNN NNSSSSNYGH GGFNPIKQIQ  240
DVHVMSTSNC TTSTTSLLSS YPNMFGSSSS TSTMASLIAS SLQQQKFMSN INGNSFHSLL  300
TPNNYEELQM SRGENNNTNI NNVHEGGGNG ITMLKEEKMD LSNHQIHEQI INSSDPSLSW  360
NGAWLDPSNM GSNSVPSLI*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6726010.0DQ672601.1 Lycopersicon esculentum cultivar Ailsa Craig leucine-rich repeat family protein, putative polyprotein, auxin repressed/dormancy associated protein, putative zinc finger protein, putative protease/hydrolase, mitochondrial amino acid carrier, squamosa promoter binding-like protein, putative retroelement pol polyprotein, and Dof zinc finger protein genes, complete cds.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232898.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLQ0PY330.0Q0PY33_SOLLC; Dof zinc finger protein
STRINGSolyc02g077950.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.24e-36Dof family protein